| Class g: Small proteins [56992] (100 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein automated matches [190700] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries) |
| Domain d5m6ha1: 5m6h A:249-351 [334535] Other proteins in same PDB: d5m6ha2 automated match to d2opza_ complexed with 7j6, na, zn |
PDB Entry: 5m6h (more details), 2.5 Å
SCOPe Domain Sequences for d5m6ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m6ha1 g.52.1.1 (A:249-351) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleec
Timeline for d5m6ha1: