Lineage for d5x5ta_ (5x5t A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516430Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2516431Protein automated matches [190683] (59 species)
    not a true protein
  7. 2516444Species Azospirillum brasilense [TaxId:192] [334382] (2 PDB entries)
  8. 2516445Domain d5x5ta_: 5x5t A: [334534]
    automated match to d4lihb_
    complexed with gol

Details for d5x5ta_

PDB Entry: 5x5t (more details), 2.25 Å

PDB Description: crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense
PDB Compounds: (A:) Alpha-ketoglutaric semialdehyde dehydrogenase

SCOPe Domain Sequences for d5x5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x5ta_ c.82.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
tytdtqllidgewvdaasgktidvvnpatgkpigrvahagiadldralaaaqsgfeawrk
vpaheraatmrkaaalvreradaiaqlmtqeqgkpltearvevlsaadiiewfadegrrv
ygrivpprnlgaqqtvvkepvgpvaaftpwnfpvnqvvrklsaalatgcsflvkapeetp
aspaallrafvdagvpagviglvygdpaeissyliphpvirkvtftgstpvgkqlaslag
lhmkratmelgghapvivaedadvalavkaaggakfrnagqvcisptrflvhnsirdeft
ralvkhaeglkvgngleegttlgalanprrltamasvidnarkvgasietggerigsegn
ffaptvianvpldadvfnnepfgpvaairgfdkleeaiaeanrlpfglagyaftrsfanv
hlltqrlevgmlwinqpatpwpempfggvkdsgygseggpealepylvtksvtvma

SCOPe Domain Coordinates for d5x5ta_:

Click to download the PDB-style file with coordinates for d5x5ta_.
(The format of our PDB-style files is described here.)

Timeline for d5x5ta_: