Lineage for d1e4ft1 (1e4f T:7-199)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701286Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 701451Protein Cell division protein FtsA [53078] (1 species)
  7. 701452Species Thermotoga maritima [TaxId:2336] [53079] (2 PDB entries)
  8. 701453Domain d1e4ft1: 1e4f T:7-199 [33453]

Details for d1e4ft1

PDB Entry: 1e4f (more details), 1.9 Å

PDB Description: ftsa (apo form) from thermotoga maritima
PDB Compounds: (T:) cell division protein ftsa

SCOP Domain Sequences for d1e4ft1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
tvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllke
leeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkeng
ktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfq
lksslvstaegvl

SCOP Domain Coordinates for d1e4ft1:

Click to download the PDB-style file with coordinates for d1e4ft1.
(The format of our PDB-style files is described here.)

Timeline for d1e4ft1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4ft2