Lineage for d5n0ya1 (5n0y A:3-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772178Family b.6.1.6: Peptidylarginine deiminase Pad4, N-terminal domain [110107] (1 protein)
    probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF08526
  6. 2772179Protein Peptidylarginine deiminase Pad4, N-terminal domain [110108] (1 species)
  7. 2772180Species Human (Homo sapiens) [TaxId:9606] [110109] (16 PDB entries)
    Uniprot Q9UM07
  8. 2772190Domain d5n0ya1: 5n0y A:3-112 [334520]
    Other proteins in same PDB: d5n0ya2, d5n0ya3
    automated match to d1wd8a2
    complexed with 8fq, ca, so4

Details for d5n0ya1

PDB Entry: 5n0y (more details), 2.23 Å

PDB Description: hpad4 crystal complex with afm-30a
PDB Compounds: (A:) Protein-arginine deiminase type-4

SCOPe Domain Sequences for d5n0ya1:

Sequence, based on SEQRES records: (download)

>d5n0ya1 b.6.1.6 (A:3-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahsppakkks
tgsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta

Sequence, based on observed residues (ATOM records): (download)

>d5n0ya1 b.6.1.6 (A:3-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahstwpldpg
vevtltmkaasgstgdqkvqisyygpktppvkallylta

SCOPe Domain Coordinates for d5n0ya1:

Click to download the PDB-style file with coordinates for d5n0ya1.
(The format of our PDB-style files is described here.)

Timeline for d5n0ya1: