SCOPe 2.06: Domain d5h5ia1: 5h5i A:12-208

Lineage for d5h5ia1 (5h5i A:12-208)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [334406] (7 PDB entries)

8. Domain d5h5ia1: 5h5i A:12-208 [334517]
   Other proteins in same PDB: d5h5ia2, d5h5ia3
   automated match to d4m8ia1
   complexed with gdp; mutant

Details for d5h5ia1

PDB Entry: 5h5i, 1.9 Å

PDB Description: staphylococcus aureus ftsz-gdp r29a mutant in r state

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5h5ia1:

Sequence; same for both SEQRES and ATOM records:

>d5h5ia1 c.32.1.1 (A:12-208) automated matches {Staphylococcus aureus [TaxId: 282458]}
atlkvigvggggnnavnamidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

Timeline for d5h5ia1:

• d5h5ia1 is new in SCOPe 2.06-stable
  
• d5h5ia1 appears in SCOPe 2.07
  
• d5h5ia1 appears in the current release, SCOPe 2.08