Lineage for d5ly7b1 (5ly7 B:1-332)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. Protein automated matches [190075] (131 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:208964] [332878] (7 PDB entries)
  8. Domain d5ly7b1: 5ly7 B:1-332 [334512]
    Other proteins in same PDB: d5ly7a2, d5ly7b2
    automated match to d3gs6a_
    complexed with nok, peg; mutant

Details for d5ly7b1

PDB Entry: 5ly7 (more details), 3.1 Å

PDB Description: crystal structure of nagz h174a mutant from pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin
PDB Compounds: (B:) Beta-hexosaminidase

SCOPe Domain Sequences for d5ly7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ly7b1 c.1.8.0 (B:1-332) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdllla
vdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvldl
dhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadsavaiped
arsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdgv
ifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrlq
rmrgkgyantdyrqqprwlealsalraaqlid

SCOPe Domain Coordinates for d5ly7b1 are not available.

Timeline for d5ly7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ly7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ly7a1, d5ly7a2