SCOPe 2.08: Domain d5m6ea1: 5m6e A:249-353

Lineage for d5m6ea1 (5m6e A:249-353)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d5m6ea1: 5m6e A:249-353 [334504]
   Other proteins in same PDB: d5m6ea2
   automated match to d2opza_
   complexed with 7ht, dms, na, zn

Details for d5m6ea1

PDB Entry: 5m6e, 2.32 Å

PDB Description: small molecule inhibitors of iap

PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d5m6ea1:

Sequence; same for both SEQRES and ATOM records:

>d5m6ea1 g.52.1.1 (A:249-353) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclv

Timeline for d5m6ea1:

• d5m6ea1 first appeared in SCOPe 2.06
  
• d5m6ea1 appears in SCOPe 2.07