| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Vibrio vulnificus [TaxId:914127] [334439] (3 PDB entries) |
| Domain d5k2ia1: 5k2i A:1-153 [334493] Other proteins in same PDB: d5k2ia2, d5k2ib2 automated match to d1tp9a1 |
PDB Entry: 5k2i (more details), 1.48 Å
SCOPe Domain Sequences for d5k2ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k2ia1 c.47.1.0 (A:1-153) automated matches {Vibrio vulnificus [TaxId: 914127]}
miaqgqtlpnatlsqltkegmvhhpvlelfagkkvvlfavpgaftptcseahlpgyivla
dqlkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfggl
rsqryamiidngvvttlnveapksfevsnaeti
Timeline for d5k2ia1: