Lineage for d5k2ia1 (5k2i A:1-153)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880509Species Vibrio vulnificus [TaxId:914127] [334439] (3 PDB entries)
  8. 2880510Domain d5k2ia1: 5k2i A:1-153 [334493]
    Other proteins in same PDB: d5k2ia2, d5k2ib2
    automated match to d1tp9a1

Details for d5k2ia1

PDB Entry: 5k2i (more details), 1.48 Å

PDB Description: crystal structure of oxidized prx3 from vibrio vulnificus
PDB Compounds: (A:) 1-Cys peroxiredoxin

SCOPe Domain Sequences for d5k2ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k2ia1 c.47.1.0 (A:1-153) automated matches {Vibrio vulnificus [TaxId: 914127]}
miaqgqtlpnatlsqltkegmvhhpvlelfagkkvvlfavpgaftptcseahlpgyivla
dqlkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfggl
rsqryamiidngvvttlnveapksfevsnaeti

SCOPe Domain Coordinates for d5k2ia1:

Click to download the PDB-style file with coordinates for d5k2ia1.
(The format of our PDB-style files is described here.)

Timeline for d5k2ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5k2ia2