Lineage for d5gmmb_ (5gmm B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2402230Protein automated matches [190681] (2 species)
    not a true protein
  7. 2402240Species Human (Homo sapiens) [TaxId:9606] [187805] (28 PDB entries)
  8. 2402275Domain d5gmmb_: 5gmm B: [334491]
    automated match to d3d0na_
    complexed with 949, zn

Details for d5gmmb_

PDB Entry: 5gmm (more details), 2 Å

PDB Description: crystal structure of human carbonic anhydrase i in complex with polmacoxib
PDB Compounds: (B:) Carbonic anhydrase 1

SCOPe Domain Sequences for d5gmmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmmb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

SCOPe Domain Coordinates for d5gmmb_:

Click to download the PDB-style file with coordinates for d5gmmb_.
(The format of our PDB-style files is described here.)

Timeline for d5gmmb_: