![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin [53073] (10 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries) |
![]() | Domain d1yaga1: 1yag A:4-146 [33449] Other proteins in same PDB: d1yagg_ complexed with atp, ca, mg, so4 |
PDB Entry: 1yag (more details), 1.9 Å
SCOPe Domain Sequences for d1yaga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yaga1 c.55.1.1 (A:4-146) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim fetfnvpafyvsiqavlslyssg
Timeline for d1yaga1: