SCOPe 2.08: Domain d5lu4a1: 5lu4 A:1-380

Lineage for d5lu4a1 (5lu4 A:1-380)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries)

8. Domain d5lu4a1: 5lu4 A:1-380 [334488]
   Other proteins in same PDB: d5lu4a2, d5lu4a3, d5lu4b2, d5lu4b3
   automated match to d1vbga3
   complexed with adp, mg, pyr

Details for d5lu4a1

PDB Entry: 5lu4, 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism

PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5lu4a1:

Sequence; same for both SEQRES and ATOM records:

>d5lu4a1 d.142.1.0 (A:1-380) automated matches {Flaveria trinervia [TaxId: 4227]}
kkrvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngksl
ppglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkd
lvekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qsmvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmp
eaykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllhp

Timeline for d5lu4a1:

• d5lu4a1 first appeared in SCOPe 2.06
  
• d5lu4a1 appears in SCOPe 2.07