Lineage for d5m6nb1 (5m6n B:260-350)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264524Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2264525Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2264526Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2264660Protein automated matches [190700] (1 species)
    not a true protein
  7. 2264661Species Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries)
  8. 2264690Domain d5m6nb1: 5m6n B:260-350 [334482]
    Other proteins in same PDB: d5m6na2, d5m6nb2
    automated match to d1qbha_
    complexed with 7h9, so4, zn

Details for d5m6nb1

PDB Entry: 5m6n (more details), 1.8 Å

PDB Description: small molecule inhibitors of iap
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d5m6nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m6nb1 g.52.1.1 (B:260-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddpwve
hakwfprceflirmkgqefvdeiqgryphll

SCOPe Domain Coordinates for d5m6nb1:

Click to download the PDB-style file with coordinates for d5m6nb1.
(The format of our PDB-style files is described here.)

Timeline for d5m6nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m6nb2