Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) contains barrel, closed, n=7, S=10 |
Family c.8.1.0: automated matches [310665] (1 protein) not a true family |
Protein automated matches [310840] (3 species) not a true protein |
Species Flaveria trinervia [TaxId:4227] [332554] (3 PDB entries) |
Domain d5lu4b2: 5lu4 B:381-515 [334480] Other proteins in same PDB: d5lu4a1, d5lu4a3, d5lu4b1, d5lu4b3 automated match to d1vbga2 complexed with adp, mg, pyr |
PDB Entry: 5lu4 (more details), 2.9 Å
SCOPe Domain Sequences for d5lu4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lu4b2 c.8.1.0 (B:381-515) automated matches {Flaveria trinervia [TaxId: 4227]} qfedpsaykshvvatglpaspgaavgqvcfsaedaetwhaqgksailvrtetspedvggm haaagiltarggmtshaavvargwgkccvsgcadirvnddmkiftigdrvikegdwlsln gttgevilgkqllap
Timeline for d5lu4b2: