Lineage for d5ghgb_ (5ghg B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2472869Species Ochrobactrum anthropi [TaxId:439375] [334452] (2 PDB entries)
  8. 2472873Domain d5ghgb_: 5ghg B: [334453]
    automated match to d4e3qa_
    complexed with pmp

Details for d5ghgb_

PDB Entry: 5ghg (more details), 2 Å

PDB Description: transaminase w58l with smba
PDB Compounds: (B:) Aminotransferase class-III

SCOPe Domain Sequences for d5ghgb_:

Sequence, based on SEQRES records: (download)

>d5ghgb_ c.67.1.0 (B:) automated matches {Ochrobactrum anthropi [TaxId: 439375]}
pnsleardiryhlhsytdavrleaegplviergdgiyvedvsgkryieamsgllsvgvgf
seprlaeaaarqmkklpfyhtfsyrshgpvidlaeklvsmapvpmskayftnsgseandt
vvkliwyrsnalgeperkkiisrkrgyhgvtiasasltglpnnhrsfdlpidrilhtgcp
hfyregqageseeqfatrladeleqliiaegphtiaafigepvmgaggvvvppktywekv
qavlkrydilliadevicgfgrtgnlfgsqtfdmkpdilvmskqlsssylpisafliner
vyapiaeeshkigtlgtgftasghpvaaavalenlaiieerdlvanardrgtymqkrlre
lqdhplvgevrgvgliagvelvtdkqaktgleptgalgakanavlqergvisramgdtla
fcppliindqqvdtmvsaleatlndvqasltr

Sequence, based on observed residues (ATOM records): (download)

>d5ghgb_ c.67.1.0 (B:) automated matches {Ochrobactrum anthropi [TaxId: 439375]}
pnsleardiryhlhsytdavrleaegplviergdgiyvedvsgkryieamsgllsvgvgf
seprlaeaaarqmkklpfyhtfhgpvidlaeklvsmapvpmskayftnsgseandtvvkl
iwyrsnalgeperkkiisrkrgyhgvtiasasltglpnnhrsfdlpidrilhtgcphfyr
egqageseeqfatrladeleqliiaegphtiaafigepvmgaggvvvppktywekvqavl
krydilliadevicgfgrtgnlfgsqtfdmkpdilvmskqlsssylpisaflinervyap
iasghpvaaavalenlaiieerdlvanardrgtymqkrlrelqdhplvgevrgvgliagv
elvtdkqaktgleptgalgakanavlqergvisramgdtlafcppliindqqvdtmvsal
eatlndvqasltr

SCOPe Domain Coordinates for d5ghgb_:

Click to download the PDB-style file with coordinates for d5ghgb_.
(The format of our PDB-style files is described here.)

Timeline for d5ghgb_: