Lineage for d5jrna_ (5jrn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780290Species Fusarium oxysporum [TaxId:1089449] [334450] (1 PDB entry)
  8. 2780291Domain d5jrna_: 5jrn A: [334451]
    automated match to d2vgda_
    complexed with 6mj, gol

Details for d5jrna_

PDB Entry: 5jrn (more details), 2.84 Å

PDB Description: crystal structure of a xylanase in complex with a monosaccharide at 2.84 angstroem resolution
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d5jrna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrna_ b.29.1.11 (A:) automated matches {Fusarium oxysporum [TaxId: 1089449]}
rtqpttgtsggyyfsfwtdtpnsvtytngnggqfsmqwsgngnhvggkgwmpgtsrtiky
sgsynpngnsylavygwtrnplieyyivenfgtynpssggqkkgevnvdgsvydiyvstr
vnapsidgnktfqqywsvrrnkrssgsvntgahfqawknvglnlgthdyqilavegyyss
gsasmtvsq

SCOPe Domain Coordinates for d5jrna_:

Click to download the PDB-style file with coordinates for d5jrna_.
(The format of our PDB-style files is described here.)

Timeline for d5jrna_: