Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species Fusarium oxysporum [TaxId:1089449] [334450] (1 PDB entry) |
Domain d5jrna_: 5jrn A: [334451] automated match to d2vgda_ complexed with 6mj, gol |
PDB Entry: 5jrn (more details), 2.84 Å
SCOPe Domain Sequences for d5jrna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jrna_ b.29.1.11 (A:) automated matches {Fusarium oxysporum [TaxId: 1089449]} rtqpttgtsggyyfsfwtdtpnsvtytngnggqfsmqwsgngnhvggkgwmpgtsrtiky sgsynpngnsylavygwtrnplieyyivenfgtynpssggqkkgevnvdgsvydiyvstr vnapsidgnktfqqywsvrrnkrssgsvntgahfqawknvglnlgthdyqilavegyyss gsasmtvsq
Timeline for d5jrna_: