| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [334399] (2 PDB entries) |
| Domain d5jp5a_: 5jp5 A: [334446] automated match to d2d6pb_ complexed with peg |
PDB Entry: 5jp5 (more details), 1.7 Å
SCOPe Domain Sequences for d5jp5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jp5a_ b.29.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlavpfftsipnglypsksivisgvvlsdakrfqinlrcggdiafhlnprfdenavvrnt
qinnswgpeerslpgsmpfsrgqrfsvwilceghcfkvavdgqhiceyshrlmnlpdint
levagdiqlthvet
Timeline for d5jp5a_: