Lineage for d1c0ga2 (1c0g A:147-375)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488064Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 488065Protein Actin [53073] (6 species)
  7. 488131Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)
  8. 488141Domain d1c0ga2: 1c0g A:147-375 [33444]
    Other proteins in same PDB: d1c0gs_
    dictyostelium/tetrahymena chimera

Details for d1c0ga2

PDB Entry: 1c0g (more details), 2 Å

PDB Description: crystal structure of 1:1 complex between gelsolin segment 1 and a dictyostelium/tetrahymena chimera actin (mutant 228: q228k/t229a/a230y/e360h)

SCOP Domain Sequences for d1c0ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0ga2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum)}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemkayasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskheydesgpsivhrkcf

SCOP Domain Coordinates for d1c0ga2:

Click to download the PDB-style file with coordinates for d1c0ga2.
(The format of our PDB-style files is described here.)

Timeline for d1c0ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0ga1
View in 3D
Domains from other chains:
(mouse over for more information)
d1c0gs_