Lineage for d5jmxa_ (5jmx A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. Protein Zn metallo-beta-lactamase [56283] (13 species)
  7. Species Bacillus cereus [TaxId:1396] [56284] (30 PDB entries)
    Uniprot P04190 31-257
  8. Domain d5jmxa_: 5jmx A: [334438]
    automated match to d1mqoa_
    complexed with dz5, gol, so4, zn

Details for d5jmxa_

PDB Entry: 5jmx (more details), 1.44 Å

PDB Description: crystal structure of bcii metallo-beta-lactamase in complex with dz- 305
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5jmxa_:

Sequence, based on SEQRES records: (download)

>d5jmxa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
eliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplg
dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvaday
vnewstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d5jmxa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliem
vekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtv
tnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnews
tsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d5jmxa_ are not available.

Timeline for d5jmxa_: