![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (10 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:282458] [334406] (7 PDB entries) |
![]() | Domain d5h5ha1: 5h5h A:12-208 [334429] Other proteins in same PDB: d5h5ha2, d5h5ha3 automated match to d4m8ia1 complexed with ca, gdp; mutant |
PDB Entry: 5h5h (more details), 1.7 Å
SCOPe Domain Sequences for d5h5ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h5ha1 c.32.1.1 (A:12-208) automated matches {Staphylococcus aureus [TaxId: 282458]} atlkvigvggggnnavnamidhgmnnvefiaintdgqalnlskaeskiqigekltrglga ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr qgvqgisdliavsgevn
Timeline for d5h5ha1: