Lineage for d5h5gb2 (5h5g B:209-315)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201804Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2201805Protein automated matches [226843] (8 species)
    not a true protein
  7. 2201835Species Staphylococcus aureus [TaxId:282458] [334408] (7 PDB entries)
  8. 2201843Domain d5h5gb2: 5h5g B:209-315 [334409]
    Other proteins in same PDB: d5h5ga1, d5h5ga3, d5h5gb1, d5h5gb3
    automated match to d4m8ia2
    complexed with ca, gdp

Details for d5h5gb2

PDB Entry: 5h5g (more details), 2.2 Å

PDB Description: staphylococcus aureus ftsz-gdp in t and r states
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d5h5gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5gb2 d.79.2.0 (B:209-315) automated matches {Staphylococcus aureus [TaxId: 282458]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d5h5gb2:

Click to download the PDB-style file with coordinates for d5h5gb2.
(The format of our PDB-style files is described here.)

Timeline for d5h5gb2: