![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (7 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:282458] [334406] (7 PDB entries) |
![]() | Domain d5h5gb1: 5h5g B:12-208 [334407] Other proteins in same PDB: d5h5ga2, d5h5ga3, d5h5gb2, d5h5gb3 automated match to d4m8ia1 complexed with ca, gdp |
PDB Entry: 5h5g (more details), 2.2 Å
SCOPe Domain Sequences for d5h5gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h5gb1 c.32.1.1 (B:12-208) automated matches {Staphylococcus aureus [TaxId: 282458]} atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr qgvqgisdliavsgevn
Timeline for d5h5gb1: