Lineage for d5h5gb1 (5h5g B:12-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2864110Species Staphylococcus aureus [TaxId:282458] [334406] (9 PDB entries)
  8. 2864118Domain d5h5gb1: 5h5g B:12-208 [334407]
    Other proteins in same PDB: d5h5ga2, d5h5ga3, d5h5gb2, d5h5gb3
    automated match to d4m8ia1
    complexed with ca, gdp

Details for d5h5gb1

PDB Entry: 5h5g (more details), 2.2 Å

PDB Description: staphylococcus aureus ftsz-gdp in t and r states
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d5h5gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5gb1 c.32.1.1 (B:12-208) automated matches {Staphylococcus aureus [TaxId: 282458]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d5h5gb1:

Click to download the PDB-style file with coordinates for d5h5gb1.
(The format of our PDB-style files is described here.)

Timeline for d5h5gb1: