Lineage for d5vn1c1 (5vn1 C:1-163,C:340-374)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055978Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2055999Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2056016Species Horse (Equus caballus) [TaxId:9796] [50138] (46 PDB entries)
    Uniprot P00327
  8. 2056053Domain d5vn1c1: 5vn1 C:1-163,C:340-374 [334396]
    Other proteins in same PDB: d5vn1a2, d5vn1b2, d5vn1c2, d5vn1d2
    automated match to d1heta1
    complexed with mrd, nai, nmh, nwh, zn

Details for d5vn1c1

PDB Entry: 5vn1 (more details), 1.25 Å

PDB Description: horse liver alcohol dehydrogenae complexed with nadh (r,s)-n-1- methylhexylformamide
PDB Compounds: (C:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d5vn1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vn1c1 b.35.1.2 (C:1-163,C:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d5vn1c1:

Click to download the PDB-style file with coordinates for d5vn1c1.
(The format of our PDB-style files is described here.)

Timeline for d5vn1c1: