SCOPe 2.07: Domain d5vl1b1: 5vl1 B:8-148

Lineage for d5vl1b1 (5vl1 B:8-148)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.0: automated matches [191416] (1 protein)
not a true family
Protein automated matches [190576] (50 species)
not a true protein
Species Mycobacterium ulcerans [TaxId:362242] [334392] (2 PDB entries)
Domain d5vl1b1: 5vl1 B:8-148 [334393]
Other proteins in same PDB: d5vl1a2, d5vl1b2, d5vl1c2, d5vl1d2
automated match to d3bjua1
protein/RNA complex; complexed with lys, peg, pge

Details for d5vl1b1

PDB Entry: 5vl1 (more details), 2.7 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium ulcerans complexed with l-lysine

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d5vl1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vl1b1 b.40.4.0 (B:8-148) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
ipeqfrirrdkrarllaegydpypvaierthtlaeiratyadlptdsatedivgvagrvv
farntgklcfatlqdgdgtqlqamisldevgresldrwkadvdigdvvyvhgtvissrrg
elsvladswrmaakalrplpv

SCOPe Domain Coordinates for d5vl1b1:

Click to download the PDB-style file with coordinates for d5vl1b1.
(The format of our PDB-style files is described here.)

Timeline for d5vl1b1: