Lineage for d5vnxc_ (5vnx C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504498Species Burkholderia multivorans [TaxId:395019] [334355] (1 PDB entry)
  8. 2504501Domain d5vnxc_: 5vnx C: [334388]
    automated match to d5jayb_
    complexed with ben, edo, so4

Details for d5vnxc_

PDB Entry: 5vnx (more details), 1.65 Å

PDB Description: crystal structure of an 8-amino-7-oxononanoate synthase from burkholderia multivorans with a potential glycine-plp-lys242 cyclized intermediate or byproduct
PDB Compounds: (C:) 8-amino-7-oxononanoate synthase

SCOPe Domain Sequences for d5vnxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vnxc_ c.67.1.0 (C:) automated matches {Burkholderia multivorans [TaxId: 395019]}
nlldtlqrgladldaqglrrvrrtadsacdahmtvngreivgfasndylglaahpklvaa
faegaqrygsgsggshllgghsrahakledelagfaggfsdapralyfstgymanlaavt
alagkdatifsdalnhaslidgtrlsratvqvyphadtatlgalleactsqtklivtdtv
fsmdgdiaplaellalaerhgawlvvddahgfgvlgpqgrgalaaaalrsphlvyvgtlg
xaagvagafvvahetviewliqrarsyifttaappavahavsaslkviagdegdarrahl
aaliertrallrrtrwqpvdshtavqplvigsneatlaamraldahglwvpairpptvpa
gtsrlrislsaahsfddlarletallraseea

SCOPe Domain Coordinates for d5vnxc_:

Click to download the PDB-style file with coordinates for d5vnxc_.
(The format of our PDB-style files is described here.)

Timeline for d5vnxc_: