Lineage for d5x7ea1 (5x7e A:4-406)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (72 species)
    not a true protein
  7. 2332188Species Streptomyces griseolus [TaxId:1909] [188416] (6 PDB entries)
  8. 2332194Domain d5x7ea1: 5x7e A:4-406 [334386]
    Other proteins in same PDB: d5x7ea2
    automated match to d4ubsa_
    complexed with 7zu, hem; mutant

Details for d5x7ea1

PDB Entry: 5x7e (more details), 1.9 Å

PDB Description: crystal structure of vitamin d hydroxylase cytochrome p450 105a1 (r84a mutant) in complex with 1,25-dihydroxyvitamin d2
PDB Compounds: (A:) Vitamin D3 dihydroxylase

SCOPe Domain Sequences for d5x7ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x7ea1 a.104.1.0 (A:4-406) automated matches {Streptomyces griseolus [TaxId: 1909]}
tattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkl
lgdprlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmr
peveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqs
tdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllli
aghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadi
evegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarl
elevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtw

SCOPe Domain Coordinates for d5x7ea1:

Click to download the PDB-style file with coordinates for d5x7ea1.
(The format of our PDB-style files is described here.)

Timeline for d5x7ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5x7ea2