![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces griseolus [TaxId:1909] [188416] (6 PDB entries) |
![]() | Domain d5x7ea1: 5x7e A:4-406 [334386] Other proteins in same PDB: d5x7ea2 automated match to d4ubsa_ complexed with 7zu, hem; mutant |
PDB Entry: 5x7e (more details), 1.9 Å
SCOPe Domain Sequences for d5x7ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x7ea1 a.104.1.0 (A:4-406) automated matches {Streptomyces griseolus [TaxId: 1909]} tattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkl lgdprlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmr peveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqs tdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllli aghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadi evegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarl elevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtw
Timeline for d5x7ea1: