SCOPe 2.07: Domain d5vf9b1: 5vf9 B:0-83

Lineage for d5vf9b1 (5vf9 B:0-83)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (31 PDB entries)

8. Domain d5vf9b1: 5vf9 B:0-83 [334384]
   Other proteins in same PDB: d5vf9a2, d5vf9b2
   automated match to d1n0ja1
   complexed with k, mn, po4

Details for d5vf9b1

PDB Entry: 5vf9, 1.82 Å

PDB Description: native human manganese superoxide dismutase

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5vf9b1:

Sequence; same for both SEQRES and ATOM records:

>d5vf9b1 a.2.11.1 (B:0-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia
lqpalkfnggghinhsifwtnlsp

Timeline for d5vf9b1:

• d5vf9b1 first appeared in SCOPe 2.06