Lineage for d5vf9b1 (5vf9 B:1-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690176Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2690240Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries)
  8. 2690278Domain d5vf9b1: 5vf9 B:1-83 [334384]
    Other proteins in same PDB: d5vf9a2, d5vf9a3, d5vf9b2, d5vf9b3
    automated match to d1n0ja1
    complexed with k, mn, po4

Details for d5vf9b1

PDB Entry: 5vf9 (more details), 1.82 Å

PDB Description: native human manganese superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5vf9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vf9b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d5vf9b1:

Click to download the PDB-style file with coordinates for d5vf9b1.
(The format of our PDB-style files is described here.)

Timeline for d5vf9b1: