Lineage for d5x5ub_ (5x5u B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909046Species Azospirillum brasilense [TaxId:192] [334382] (2 PDB entries)
  8. 2909050Domain d5x5ub_: 5x5u B: [334383]
    automated match to d4lihb_
    complexed with gol, nad

Details for d5x5ub_

PDB Entry: 5x5u (more details), 2.3 Å

PDB Description: crystal structure of alpha-ketoglutarate-semialdehyde dehydrogenase (kgsadh) complexed with nad
PDB Compounds: (B:) Alpha-ketoglutaric semialdehyde dehydrogenase

SCOPe Domain Sequences for d5x5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x5ub_ c.82.1.0 (B:) automated matches {Azospirillum brasilense [TaxId: 192]}
tytdtqllidgewvdaasgktidvvnpatgkpigrvahagiadldralaaaqsgfeawrk
vpaheraatmrkaaalvreradaiaqlmtqeqgkpltearvevlsaadiiewfadegrrv
ygrivpprnlgaqqtvvkepvgpvaaftpwnfpvnqvvrklsaalatgcsflvkapeetp
aspaallrafvdagvpagviglvygdpaeissyliphpvirkvtftgstpvgkqlaslag
lhmkratmelgghapvivaedadvalavkaaggakfrnagqvcisptrflvhnsirdeft
ralvkhaeglkvgngleegttlgalanprrltamasvidnarkvgasietggerigsegn
ffaptvianvpldadvfnnepfgpvaairgfdkleeaiaeanrlpfglagyaftrsfanv
hlltqrlevgmlwinqpatpwpempfggvkdsgygseggpealepylvtksvtvma

SCOPe Domain Coordinates for d5x5ub_:

Click to download the PDB-style file with coordinates for d5x5ub_.
(The format of our PDB-style files is described here.)

Timeline for d5x5ub_: