Lineage for d5vf9a2 (5vf9 A:84-198)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2513722Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2513848Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2513912Species Human (Homo sapiens) [TaxId:9606] [54724] (31 PDB entries)
  8. 2513947Domain d5vf9a2: 5vf9 A:84-198 [334381]
    Other proteins in same PDB: d5vf9a1, d5vf9b1
    automated match to d1n0ja2
    complexed with k, mn, po4

Details for d5vf9a2

PDB Entry: 5vf9 (more details), 1.82 Å

PDB Description: native human manganese superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5vf9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vf9a2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d5vf9a2:

Click to download the PDB-style file with coordinates for d5vf9a2.
(The format of our PDB-style files is described here.)

Timeline for d5vf9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vf9a1