![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) ![]() |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (3 proteins) |
![]() | Protein Actin [53073] (4 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (4 PDB entries) |
![]() | Domain d1atna2: 1atn A:147-372 [33438] Other proteins in same PDB: d1atnd_ |
PDB Entry: 1atn (more details), 2.8 Å
SCOP Domain Sequences for d1atna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atna2 c.55.1.1 (A:147-372) Actin {Rabbit (Oryctolagus cuniculus)} rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr
Timeline for d1atna2: