SCOPe 2.08: Domain d1atna2: 1atn A:147-372

Lineage for d1atna2 (1atn A:147-372)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1atna2: 1atn A:147-372 [33438]
   Other proteins in same PDB: d1atnd_
   protein/DNA complex; complexed with atp, ca

Details for d1atna2

PDB Entry: 1atn, 2.8 Å

PDB Description: atomic structure of the actin:dnase i complex

PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1atna2:

Sequence; same for both SEQRES and ATOM records:

>d1atna2 c.55.1.1 (A:147-372) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

Timeline for d1atna2:

• d1atna2 first appeared (with stable ids) in SCOP 1.55
  
• d1atna2 appears in SCOPe 2.07