Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:521006] [334345] (1 PDB entry) |
Domain d5vrbd3: 5vrb D:525-659 [334372] Other proteins in same PDB: d5vrba1, d5vrba2, d5vrbb1, d5vrbb2, d5vrbc1, d5vrbc2, d5vrbd1, d5vrbd2 automated match to d2r8oa3 complexed with ca, edo |
PDB Entry: 5vrb (more details), 1.85 Å
SCOPe Domain Sequences for d5vrbd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vrbd3 c.48.1.0 (D:525-659) automated matches {Neisseria gonorrhoeae [TaxId: 521006]} rseqqlndikrgayviseaqgnaqaviiatgsevglaveaqkvlagqgiavrvvsmpsts vfdrqdaayqaavlpeglpriaveaghtngwykyvglngavvginrfgesapadllfkaf gftvdnvvdtvksvl
Timeline for d5vrbd3: