SCOPe 2.08: Domain d5vrbd2: 5vrb D:330-524

Lineage for d5vrbd2 (5vrb D:330-524)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:521006] [334342] (1 PDB entry)

8. Domain d5vrbd2: 5vrb D:330-524 [334371]
   Other proteins in same PDB: d5vrba3, d5vrbb3, d5vrbc3, d5vrbd3
   automated match to d1qgda1
   complexed with ca, edo

Details for d5vrbd2

PDB Entry: 5vrb, 1.85 Å

PDB Description: crystal structure of a transketolase from neisseria gonorrhoeae

PDB Compounds: (D:) transketolase

SCOPe Domain Sequences for d5vrbd2:

Sequence, based on SEQRES records:

>d5vrbd2 c.36.1.0 (D:330-524) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
lpenfdeyvqtalkevcakaetvatrkasqnsieilakelpelvggsadltpsnltdwsn
svsvtrdkggnyihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmk
inpvfvfthdsiglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedh
psclifsrqnlkfqa

Sequence, based on observed residues (ATOM records):

>d5vrbd2 c.36.1.0 (D:330-524) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
lpenfdeyvqtalkevcaknsieilakelpelvggsadltpsnltdwsnsvsvtrdkggn
yihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthds
iglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqnl
kfqa

Timeline for d5vrbd2:

• d5vrbd2 first appeared in SCOPe 2.06
  
• d5vrbd2 appears in SCOPe 2.07