Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:521006] [334342] (1 PDB entry) |
Domain d5vrbc2: 5vrb C:330-524 [334368] Other proteins in same PDB: d5vrba3, d5vrbb3, d5vrbc3, d5vrbd3 automated match to d1qgda1 complexed with ca, edo |
PDB Entry: 5vrb (more details), 1.85 Å
SCOPe Domain Sequences for d5vrbc2:
Sequence, based on SEQRES records: (download)
>d5vrbc2 c.36.1.0 (C:330-524) automated matches {Neisseria gonorrhoeae [TaxId: 521006]} lpenfdeyvqtalkevcakaetvatrkasqnsieilakelpelvggsadltpsnltdwsn svsvtrdkggnyihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmk inpvfvfthdsiglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedh psclifsrqnlkfqa
>d5vrbc2 c.36.1.0 (C:330-524) automated matches {Neisseria gonorrhoeae [TaxId: 521006]} lpenfdeyvqtalkevcaknsieilakelpelvggsadltpsnltdwsnsvsvtrdkggn yihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthds iglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqa
Timeline for d5vrbc2: