Lineage for d5vrbc2 (5vrb C:330-524)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122891Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2122892Protein automated matches [227126] (20 species)
    not a true protein
  7. 2123077Species Neisseria gonorrhoeae [TaxId:521006] [334342] (1 PDB entry)
  8. 2123083Domain d5vrbc2: 5vrb C:330-524 [334368]
    Other proteins in same PDB: d5vrba3, d5vrbb3, d5vrbc3, d5vrbd3
    automated match to d1qgda1
    complexed with ca, edo

Details for d5vrbc2

PDB Entry: 5vrb (more details), 1.85 Å

PDB Description: crystal structure of a transketolase from neisseria gonorrhoeae
PDB Compounds: (C:) transketolase

SCOPe Domain Sequences for d5vrbc2:

Sequence, based on SEQRES records: (download)

>d5vrbc2 c.36.1.0 (C:330-524) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
lpenfdeyvqtalkevcakaetvatrkasqnsieilakelpelvggsadltpsnltdwsn
svsvtrdkggnyihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmk
inpvfvfthdsiglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedh
psclifsrqnlkfqa

Sequence, based on observed residues (ATOM records): (download)

>d5vrbc2 c.36.1.0 (C:330-524) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
lpenfdeyvqtalkevcaknsieilakelpelvggsadltpsnltdwsnsvsvtrdkggn
yihygvrefgmgaimnglvlhggvkpfgatflmfseyernalrmaalmkinpvfvfthds
iglgedgpthqpieqtatlrlipnmdvwrpcdtaeslvawaeaakaedhpsclifsrqa

SCOPe Domain Coordinates for d5vrbc2:

Click to download the PDB-style file with coordinates for d5vrbc2.
(The format of our PDB-style files is described here.)

Timeline for d5vrbc2: