Lineage for d5vnxa_ (5vnx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896850Species Burkholderia multivorans [TaxId:395019] [334355] (1 PDB entry)
  8. 2896851Domain d5vnxa_: 5vnx A: [334357]
    automated match to d5jayb_
    complexed with ben, edo, so4

Details for d5vnxa_

PDB Entry: 5vnx (more details), 1.65 Å

PDB Description: crystal structure of an 8-amino-7-oxononanoate synthase from burkholderia multivorans with a potential glycine-plp-lys242 cyclized intermediate or byproduct
PDB Compounds: (A:) 8-amino-7-oxononanoate synthase

SCOPe Domain Sequences for d5vnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vnxa_ c.67.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mnlldtlqrgladldaqglrrvrrtadsacdahmtvngreivgfasndylglaahpklva
afaegaqrygsgsggshllgghsrahakledelagfaggfsdapralyfstgymanlaav
talagkdatifsdalnhaslidgtrlsratvqvyphadtatlgalleactsqtklivtdt
vfsmdgdiaplaellalaerhgawlvvddahgfgvlgpqgrgalaaaalrsphlvyvgtl
gxaagvagafvvahetviewliqrarsyifttaappavahavsaslkviagdegdarrah
laaliertrallrrtrwqpvdshtavqplvigsneatlaamraldahglwvpairpptvp
agtsrlrislsaahsfddlarletallraseea

SCOPe Domain Coordinates for d5vnxa_:

Click to download the PDB-style file with coordinates for d5vnxa_.
(The format of our PDB-style files is described here.)

Timeline for d5vnxa_: