Lineage for d5urzb_ (5urz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734685Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2734686Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2734687Family a.141.1.1: Frizzled cysteine-rich domain [63502] (3 proteins)
  6. 2734709Protein automated matches [334321] (1 species)
    not a true protein
  7. 2734710Species Human (Homo sapiens) [TaxId:9606] [334322] (3 PDB entries)
  8. 2734715Domain d5urzb_: 5urz B: [334354]
    automated match to d1ijya_
    complexed with bog

Details for d5urzb_

PDB Entry: 5urz (more details), 2.2 Å

PDB Description: crystal structure of frizzled 5 crd in complex with bog
PDB Compounds: (B:) Frizzled-5

SCOPe Domain Sequences for d5urzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5urzb_ a.141.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqeitvpmcrgigynlthmpnqfnhdtqdeaglevhqfwplveiqcspdlrfflcsmytp
iclpdyhkplppcrsvcerakagcsplmrqygfawpermscdrlpvlgrdaevlcmdye

SCOPe Domain Coordinates for d5urzb_:

Click to download the PDB-style file with coordinates for d5urzb_.
(The format of our PDB-style files is described here.)

Timeline for d5urzb_: