Lineage for d5u89b_ (5u89 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208184Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2208248Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 2208258Family d.100.2.0: automated matches [254253] (1 protein)
    not a true family
  6. 2208259Protein automated matches [254578] (5 species)
    not a true protein
  7. 2208262Species Geobacillus sp. [TaxId:581103] [334347] (1 PDB entry)
  8. 2208263Domain d5u89b_: 5u89 B: [334348]
    automated match to d2gpfa1
    complexed with mj8

Details for d5u89b_

PDB Entry: 5u89 (more details), 3.08 Å

PDB Description: crystal structure of a cross-module fragment from the dimodular nrps dhbf
PDB Compounds: (B:) MbtH domain protein

SCOPe Domain Sequences for d5u89b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u89b_ d.100.2.0 (B:) automated matches {Geobacillus sp. [TaxId: 581103]}
tnpfenkegtylvlindegqyslwpasiaippgwniafaentrsacldyinahwidmrpn
slkd

SCOPe Domain Coordinates for d5u89b_:

Click to download the PDB-style file with coordinates for d5u89b_.
(The format of our PDB-style files is described here.)

Timeline for d5u89b_: