Lineage for d5vrbb3 (5vrb B:525-659)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880787Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2880788Protein automated matches [226991] (9 species)
    not a true protein
  7. 2880836Species Neisseria gonorrhoeae [TaxId:521006] [334345] (1 PDB entry)
  8. 2880838Domain d5vrbb3: 5vrb B:525-659 [334346]
    Other proteins in same PDB: d5vrba1, d5vrba2, d5vrbb1, d5vrbb2, d5vrbc1, d5vrbc2, d5vrbd1, d5vrbd2
    automated match to d2r8oa3
    complexed with ca, edo

Details for d5vrbb3

PDB Entry: 5vrb (more details), 1.85 Å

PDB Description: crystal structure of a transketolase from neisseria gonorrhoeae
PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d5vrbb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vrbb3 c.48.1.0 (B:525-659) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
rseqqlndikrgayviseaqgnaqaviiatgsevglaveaqkvlagqgiavrvvsmpsts
vfdrqdaayqaavlpeglpriaveaghtngwykyvglngavvginrfgesapadllfkaf
gftvdnvvdtvksvl

SCOPe Domain Coordinates for d5vrbb3:

Click to download the PDB-style file with coordinates for d5vrbb3.
(The format of our PDB-style files is described here.)

Timeline for d5vrbb3: