Lineage for d5vnta_ (5vnt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311036Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 2311037Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 2311071Family a.14.1.0: automated matches [254251] (1 protein)
    not a true family
  6. 2311072Protein automated matches [254571] (2 species)
    not a true protein
  7. 2311077Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [334337] (1 PDB entry)
  8. 2311078Domain d5vnta_: 5vnt A: [334338]
    automated match to d2rjva_

Details for d5vnta_

PDB Entry: 5vnt (more details)

PDB Description: solution nmr structure of the c-terminal headpiece domain of villin 4 from a.thaliana, the first non-vertebrate headpiece structure
PDB Compounds: (A:) Villin-4

SCOPe Domain Sequences for d5vnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vnta_ a.14.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpahpydrlkttstdpvsdidvtrreaylsseefkekfgmtkeafyklpkwkqnkfkmav
qlf

SCOPe Domain Coordinates for d5vnta_:

Click to download the PDB-style file with coordinates for d5vnta_.
(The format of our PDB-style files is described here.)

Timeline for d5vnta_: