![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily) 3 short helices; irregular array |
![]() | Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) ![]() |
![]() | Family a.14.1.0: automated matches [254251] (1 protein) not a true family |
![]() | Protein automated matches [254571] (2 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [334337] (1 PDB entry) |
![]() | Domain d5vnta_: 5vnt A: [334338] automated match to d2rjva_ |
PDB Entry: 5vnt (more details)
SCOPe Domain Sequences for d5vnta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vnta_ a.14.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lpahpydrlkttstdpvsdidvtrreaylsseefkekfgmtkeafyklpkwkqnkfkmav qlf
Timeline for d5vnta_: