Lineage for d5v82a_ (5v82 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982873Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 2982874Species Human (Homo sapiens) [TaxId:9606] [118134] (118 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 2982914Domain d5v82a_: 5v82 A: [334328]
    automated match to d4b4la_
    complexed with 96y

Details for d5v82a_

PDB Entry: 5v82 (more details), 1.89 Å

PDB Description: pim1 kinase in complex with cpd17 (1-(6-(4,4-difluoropiperidin-3-yl) pyridin-2-yl)-6-(6-methylpyrazin-2-yl)-1h-pyrazolo[4,3-c]pyridine)
PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d5v82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v82a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
lesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvll
kkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvle
avrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewi
ryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclal
rpsdrptfeeiqnhpwmqdvllpqetaeihlhs

SCOPe Domain Coordinates for d5v82a_:

Click to download the PDB-style file with coordinates for d5v82a_.
(The format of our PDB-style files is described here.)

Timeline for d5v82a_: