SCOPe 2.08: Domain d5urya_: 5ury A:

Lineage for d5urya_ (5ury A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
   Core: 3 helices; irregular array; disulfide-rich

4. Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families)
   automatically mapped to Pfam PF01392

5. Family a.141.1.1: Frizzled cysteine-rich domain [63502] (3 proteins)

6. Protein automated matches [334321] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [334322] (3 PDB entries)

8. Domain d5urya_: 5ury A: [334323]
   automated match to d1ijya_
   complexed with pam

Details for d5urya_

PDB Entry: 5ury, 2.1 Å

PDB Description: crystal structure of frizzled 5 crd in complex with pam

PDB Compounds: (A:) Frizzled-5

SCOPe Domain Sequences for d5urya_:

Sequence; same for both SEQRES and ATOM records:

>d5urya_ a.141.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcqeitvpmcrgigynlthmpnqfnhdtqdeaglevhqfwplveiqcspdlrfflcsmyt
piclpdyhkplppcrsvcerakagcsplmrqygfawpermscdrlpvlgrdaevlcmdy

Timeline for d5urya_:

• d5urya_ first appeared in SCOPe 2.06
  
• d5urya_ appears in SCOPe 2.07