SCOPe 2.06: Domain d5v6ab_: 5v6a B:

Lineage for d5v6ab_ (5v6a B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d5v6ab_: 5v6a B: [334319]
   Other proteins in same PDB: d5v6aa2
   automated match to d2knba_
   complexed with cl, flc, zn

Details for d5v6ab_

PDB Entry: 5v6a, 2.7 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.2

PDB Compounds: (B:) me.2

SCOPe Domain Sequences for d5v6ab_:

Sequence, based on SEQRES records:

>d5v6ab_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrifvetlrrltitlevepsdtienvkakiqdkegippdqqrliffgqqledgrtlsdyn
ivkystlhlilrlpr

Sequence, based on observed residues (ATOM records):

>d5v6ab_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrifveltitlevepsdtienvkakiqdkegippdqqrliffgqqledgrtlsdynivky
stlhlilrlpr

Timeline for d5v6ab_:

• d5v6ab_ is new in SCOPe 2.06-stable
  
• d5v6ab_ appears in SCOPe 2.07
  
• d5v6ab_ appears in the current release, SCOPe 2.08