Lineage for d5kk7a_ (5kk7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335492Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2335493Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2335494Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2335509Species Human (Homo sapiens) [TaxId:9606] [48229] (6 PDB entries)
  8. 2335514Domain d5kk7a_: 5kk7 A: [334317]
    automated match to d1fo2a_
    complexed with 1ps, act, bu1, ca, smd, so4; mutant

Details for d5kk7a_

PDB Entry: 5kk7 (more details), 1.73 Å

PDB Description: crystal structure of the class i human endoplasmic reticulum 1,2- alpha-mannosidase t688a mutant and thio-disaccharide substrate analog complex
PDB Compounds: (A:) Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

SCOPe Domain Sequences for d5kk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kk7a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
hlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmwilglr
kefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfgnrlmp
afrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqeavekv
tqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqetqll
edyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhglpas
hmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetvesl
fylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesfflget
lkylfllfsddpnllsldayvfnaeahplpiwtpa

SCOPe Domain Coordinates for d5kk7a_:

Click to download the PDB-style file with coordinates for d5kk7a_.
(The format of our PDB-style files is described here.)

Timeline for d5kk7a_: