Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries) |
Domain d5ughc2: 5ugh C:127-251 [334298] automated match to d2p02a2 complexed with 8aj |
PDB Entry: 5ugh (more details), 2.06 Å
SCOPe Domain Sequences for d5ughc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ughc2 d.130.1.0 (C:127-251) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvtv qymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlqp sgrfv
Timeline for d5ughc2: