Lineage for d5ugha2 (5ugh A:128-251)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215558Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2215559Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2215664Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2215665Protein automated matches [254617] (10 species)
    not a true protein
  7. 2215702Species Human (Homo sapiens) [TaxId:9606] [255522] (6 PDB entries)
  8. 2215713Domain d5ugha2: 5ugh A:128-251 [334290]
    automated match to d2p02a2
    complexed with 8aj

Details for d5ugha2

PDB Entry: 5ugh (more details), 2.06 Å

PDB Description: crystal structure of mat2a bound to the allosteric inhibitor pf- 02929366
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d5ugha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugha2 d.130.1.0 (A:128-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvq
ymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlqps
grfv

SCOPe Domain Coordinates for d5ugha2:

Click to download the PDB-style file with coordinates for d5ugha2.
(The format of our PDB-style files is described here.)

Timeline for d5ugha2: