Lineage for d5n6qa_ (5n6q A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2415386Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2415387Protein automated matches [190048] (24 species)
    not a true protein
  7. 2415478Species Pseudomonas putida [TaxId:303] [187793] (24 PDB entries)
  8. 2415507Domain d5n6qa_: 5n6q A: [334285]
    automated match to d3l65a_
    complexed with 8oz, cl, fmn, gol

Details for d5n6qa_

PDB Entry: 5n6q (more details), 2.2 Å

PDB Description: xenobiotic reductase a (xena) from pseudomonas putida in complex with 2-phenylacrylic acid
PDB Compounds: (A:) NADH:flavin oxidoreductase

SCOPe Domain Sequences for d5n6qa_:

Sequence, based on SEQRES records: (download)

>d5n6qa_ c.1.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
salfepytlkdvtlrnriaippmcqymaedglindwhqvhyasmarggagllvveatava
pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiga
ddargwetiapsaiafgahlpnvpramtlddiarvkqdfvdaarrardagfewielhfah
gylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
eqtleesielarrfkaggldllsvsvgftipetnipwgpafmgpiaervrreaklpvtsa
wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle

Sequence, based on observed residues (ATOM records): (download)

>d5n6qa_ c.1.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
salfepytlkdvtlrnriaippmcqymaedglindwhqvhyasmarggagllvveatava
pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhida
rgwetiapsaiafgahlpnvpramtlddiarvkqdfvdaarrardagfewielhfahgyl
gqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrdeqt
leesielarrfkaggldllsvsvgftipetnipwgpafmgpiaervrreaklpvtsawgf
gtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle

SCOPe Domain Coordinates for d5n6qa_:

Click to download the PDB-style file with coordinates for d5n6qa_.
(The format of our PDB-style files is described here.)

Timeline for d5n6qa_: