Lineage for d5u4yd_ (5u4y D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2696965Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2696966Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)
  8. 2696975Domain d5u4yd_: 5u4y D: [334277]
    automated match to d2spza_

Details for d5u4yd_

PDB Entry: 5u4y (more details), 2.5 Å

PDB Description: igg fc bound to 3 helix of the b-domain from protein a
PDB Compounds: (D:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d5u4yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4yd_ a.8.1.1 (D:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
mkfnkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqap

SCOPe Domain Coordinates for d5u4yd_:

Click to download the PDB-style file with coordinates for d5u4yd_.
(The format of our PDB-style files is described here.)

Timeline for d5u4yd_: