Lineage for d5n55c_ (5n55 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603117Species Klebsiella pneumoniae [TaxId:573] [271524] (10 PDB entries)
  8. 2603131Domain d5n55c_: 5n55 C: [334276]
    automated match to d5a87b_
    complexed with 8nn, zn

Details for d5n55c_

PDB Entry: 5n55 (more details), 1.99 Å

PDB Description: mono-zinc vim-5 metallo-beta-lactamase in complex with (1-chloro-4- hydroxyisoquinoline-3-carbonyl)-l-tryptophan (compound 2)
PDB Compounds: (C:) Class B metallo-beta-lactamase

SCOPe Domain Sequences for d5n55c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n55c_ d.157.1.1 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggxavlalsrtsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvtahk

SCOPe Domain Coordinates for d5n55c_:

Click to download the PDB-style file with coordinates for d5n55c_.
(The format of our PDB-style files is described here.)

Timeline for d5n55c_: