Class b: All beta proteins [48724] (177 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries) |
Domain d5to2b_: 5to2 B: [334274] Other proteins in same PDB: d5to2d_ automated match to d3ry1b_ complexed with peg |
PDB Entry: 5to2 (more details), 1.65 Å
SCOPe Domain Sequences for d5to2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5to2b_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]} agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk p
Timeline for d5to2b_: